Protein Info for PS417_10585 in Pseudomonas simiae WCS417

Annotation: Cro/Cl family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 PF13560: HTH_31" amino acids 10 to 64 (55 residues), 34.3 bits, see alignment E=3.6e-12 PF01381: HTH_3" amino acids 14 to 68 (55 residues), 39.4 bits, see alignment E=7.4e-14 PF07883: Cupin_2" amino acids 115 to 184 (70 residues), 47.7 bits, see alignment E=1.6e-16

Best Hits

KEGG orthology group: None (inferred from 98% identity to pfs:PFLU2164)

Predicted SEED Role

"Transcriptional regulator, MerR family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UAC6 at UniProt or InterPro

Protein Sequence (185 amino acids)

>PS417_10585 Cro/Cl family transcriptional regulator (Pseudomonas simiae WCS417)
MTPQEELATLAALIHDLRKHKKLTLAQLAQKIERSVGFLSQVERGLSRPTVADLTAISHA
LDVPTTYFYSQPKPKAVDWITRPNERRTVYYANGITDILVSPSMNGAFSMLDSLLAPGAN
SGEQTMSDRAEQAGFVLEGELTLWVEGEADSVTLGPGDSFHLASFAHCRYANLTDLPARV
LWVYN