Protein Info for GFF2076 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Ethanolamine utilization protein EutG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 transmembrane" amino acids 262 to 281 (20 residues), see Phobius details PF00465: Fe-ADH" amino acids 27 to 194 (168 residues), 151.1 bits, see alignment E=3.4e-48 PF13685: Fe-ADH_2" amino acids 35 to 128 (94 residues), 36.1 bits, see alignment E=9.6e-13 PF25137: ADH_Fe_C" amino acids 206 to 394 (189 residues), 246 bits, see alignment E=3.9e-77

Best Hits

Swiss-Prot: 100% identical to EUTG_SALTY: Ethanolamine utilization protein EutG (eutG) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K04022, alcohol dehydrogenase (inferred from 99% identity to set:SEN2441)

Predicted SEED Role

"Ethanolamine utilization protein EutG" in subsystem Ethanolamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (395 amino acids)

>GFF2076 Ethanolamine utilization protein EutG (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MQAELQTALFQAFDTLNLQRVKTFSVPPVTLCGLGALGACGQEAQARGVSHLFVMVDSFL
HQAGMTAPLARSLAMKGVAMTVWPCPPGEPCITDVCAAVAQLREAACDGVVAFGGGSVLD
AAKAVALLVTNPDQTLSAMTEHSTLRPRLPLIAVPTTAGTGSETTNVTVIIDAVSGRKQV
LAHASLMPDVAILDAAVTEGVPPNVTAMTGIDALTHAIEAYSALNATPFTDSLAIGAIAM
IGKSLPKAVGYGHDLAARENMLLASCMAGMAFSSAGLGLCHAMAHQPGAALHIPHGQANA
MLLPTVMGFNRMVCRERFSQIGRALTNKKSDDRDAIAAVCELIAEVGQSKRLADAGAKPE
HYSAWAQAALEDICLRSNPRTATQAQIIDLYAAAG