Protein Info for GFF2072 in Xanthobacter sp. DMC5

Annotation: Adenine DNA glycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 TIGR01084: A/G-specific adenine glycosylase" amino acids 46 to 303 (258 residues), 298.5 bits, see alignment E=2.7e-93 PF00730: HhH-GPD" amino acids 77 to 194 (118 residues), 70.9 bits, see alignment E=2.1e-23 PF00633: HHH" amino acids 140 to 168 (29 residues), 30.3 bits, see alignment (E = 5.3e-11) PF10576: EndIII_4Fe-2S" amino acids 231 to 247 (17 residues), 19.8 bits, see alignment (E = 1.5e-07) PF14815: NUDIX_4" amino acids 274 to 380 (107 residues), 78.7 bits, see alignment E=6e-26

Best Hits

KEGG orthology group: K03575, A/G-specific adenine glycosylase [EC: 3.2.2.-] (inferred from 86% identity to azc:AZC_0456)

Predicted SEED Role

"A/G-specific adenine glycosylase (EC 3.2.2.-)" in subsystem DNA repair, bacterial (EC 3.2.2.-)

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-

Use Curated BLAST to search for 3.2.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (385 amino acids)

>GFF2072 Adenine DNA glycosylase (Xanthobacter sp. DMC5)
MVDDVVSEPLAPARGHGHLGRMTSSPAARAAASGAQKSGTAAPAPDALLAWYDRHRRRLP
WRAEPGRQADPYHVFLSEIMLQQTTVKAVGPYFTGFLARWPTVSHLAAAPLEEVLSAWAG
LGYYARARNLHACAQAVVARHGGRFPDDEAALLALPGIGPYTAAAIAAIAFDLKASPVDG
NIERVVSRLYRVAEPLPGAKPRIKALAAALTPAERPGDFAQAMMDLGATICTPRSPACSL
CPWMEPCDARAAGDAALYPVKAPKGEKPKREGVAFLAVRADGAVLLRTRPDKGLLAKMTE
VPSTPWGPKPEAPEAHAPLKARWRALPGAVEHVFTHFALTLKVLRADMPAGTPAPEGHRW
VTPDGFDAEALPSVMRKVLAHGGVE