Protein Info for GFF2071 in Variovorax sp. SCN45

Annotation: Metal-dependent hydrolase YbeY, involved in rRNA and/or ribosome maturation and assembly

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 PF02130: YbeY" amino acids 39 to 147 (109 residues), 99.7 bits, see alignment E=7.6e-33 TIGR00043: rRNA maturation RNase YbeY" amino acids 46 to 147 (102 residues), 101.7 bits, see alignment E=1.3e-33

Best Hits

Swiss-Prot: 78% identical to YBEY_ACIAC: Endoribonuclease YbeY (ybeY) from Acidovorax citrulli (strain AAC00-1)

KEGG orthology group: K07042, probable rRNA maturation factor (inferred from 91% identity to vpe:Varpa_5295)

Predicted SEED Role

"Metal-dependent hydrolase YbeY, involved in rRNA and/or ribosome maturation and assembly"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (155 amino acids)

>GFF2071 Metal-dependent hydrolase YbeY, involved in rRNA and/or ribosome maturation and assembly (Variovorax sp. SCN45)
MAASKLPALSLSLQFGRFKGVERHRAALPRHSVTRWVRHALDIDGEITVRIVDAEEGQRL
NREFRGKDYATNVLTFDYAQSPLVMADLVLCAPVVAREAKENRKTLADHYAHLLVHGTLH
AQGWDHETSEADADEMEAYEIEILAGLGIRSPYGK