Protein Info for PS417_10555 in Pseudomonas simiae WCS417

Annotation: major facilitator transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 541 transmembrane" amino acids 25 to 50 (26 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 120 to 143 (24 residues), see Phobius details amino acids 166 to 188 (23 residues), see Phobius details amino acids 195 to 218 (24 residues), see Phobius details amino acids 250 to 275 (26 residues), see Phobius details amino acids 287 to 309 (23 residues), see Phobius details amino acids 318 to 337 (20 residues), see Phobius details amino acids 443 to 467 (25 residues), see Phobius details amino acids 486 to 506 (21 residues), see Phobius details amino acids 512 to 530 (19 residues), see Phobius details PF00083: Sugar_tr" amino acids 26 to 334 (309 residues), 118.3 bits, see alignment E=4.3e-38 PF07690: MFS_1" amino acids 30 to 334 (305 residues), 87.8 bits, see alignment E=7e-29

Best Hits

KEGG orthology group: None (inferred from 97% identity to pfs:PFLU2159)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TYB7 at UniProt or InterPro

Protein Sequence (541 amino acids)

>PS417_10555 major facilitator transporter (Pseudomonas simiae WCS417)
MSEQAQPLGAAVNTAITRNESKKVIFASSLGTVFEWYDFFLYGALAAVISKQFFAGVNDT
TAFIFALMAFAAGFVVRPFGALVFGRLGDMIGRKYTFLVTIILMGVATFCVGLLPTYASI
GIAAPIILIVLRMLQGLALGGEYGGAATYVAEHAPAGKRGFHTSWIQSTATLGLLLSLLV
VLACRYFTGDQFEVWGWRIPFLFSIVLLGISTWIRMSLHESPAFLKMKEEGKASKSPIRD
SFGKWENLKIVLIALFSINGGQAVTFYAAQFYVLFFLTQFLKMDPALANMLLIISVVIGA
PFFIFFGWLSDKVGRKPVLMLGLLLATALYFPIFKSLAHYTNPAMDQASNQAPITVLADP
ATCTFQFDPVGKAKFDSPCDKVKTFLVKQGLPYSSAAAPAGSPVQVSVGDVRIEGFDEKA
LRGAVTLAGYPSSADVAQVNKTMVVVLIVALILIAAMCYGPLAALMVELFPTRIRYTSMS
LPYHIGNGWFGGFLPTVSFALVVYTGDIFYGLWYPVVVTGVSLIVGMICLKETRHVDIDK
N