Protein Info for GFF2065 in Xanthobacter sp. DMC5

Annotation: Acetoin catabolism regulatory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 645 PF01590: GAF" amino acids 79 to 211 (133 residues), 46.9 bits, see alignment E=1e-15 PF00158: Sigma54_activat" amino acids 331 to 492 (162 residues), 206.1 bits, see alignment E=7.4e-65 PF14532: Sigma54_activ_2" amino acids 344 to 497 (154 residues), 65.6 bits, see alignment E=1.4e-21 PF07728: AAA_5" amino acids 348 to 462 (115 residues), 25.2 bits, see alignment E=3.7e-09 PF02954: HTH_8" amino acids 608 to 640 (33 residues), 40.4 bits, see alignment (E = 4.9e-14)

Best Hits

KEGG orthology group: None (inferred from 75% identity to xau:Xaut_0367)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (645 amino acids)

>GFF2065 Acetoin catabolism regulatory protein (Xanthobacter sp. DMC5)
MPAPFPPLSPVPPPDELLTARRRFFSGAPGAEQALALPIIRSWTRCAERGLPVGGRLKAE
PLTQGELSIRRERYEALRRRCRPELEALHLSASAAGGIVILTDPTGLVLDTVGSADFADR
AAQVALRPGVSWSEADSGTNAIGTALIERRGIEVRGAEHYAEPHGILTCAAAPIHDPFGE
LVGLLDLSGPAAVPHHHALALVELAVGQVEHRLFEGAFPGRDVVRFHADPSFLGTAREGV
LVFEDHRLVAANRPALSLLGLGWDALGARRFSELFEGSLGRPGDARRARTPNGPVMLRLE
RQAPAPVRMAAVPAVAPAPAPAPAGPSFDSETEQALGRAIRLMNAGVPVLIQGETGSGKE
VFARQIHARGPRADRTFAAVNCAALPEGLIESELFGYEDGAFTGARRAGFKGLFREADGG
VLFLDEIGDMPLGLQSRLLRVLQEREVTPLGGGKAVKVDFALVCASHRDLKMLVEQGSFR
ADLYFRIAQYTVTLPPLRSLADREALVERLWRDMAGPGADAPLLSPACREALARHTWPGN
FRQLTGVLKVLLALAEPGETVGPEALPADISAADLRSPAQPAAASTLPASQAGDPAPGLS
GDLGSVTRAAMDAALKECDGNISRAARRLGIHRSTLHRHLASRGH