Protein Info for PS417_10515 in Pseudomonas simiae WCS417

Annotation: acetyl-CoA acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 PF00108: Thiolase_N" amino acids 4 to 262 (259 residues), 360.7 bits, see alignment E=6.4e-112 TIGR01930: acetyl-CoA C-acyltransferase" amino acids 6 to 391 (386 residues), 494.1 bits, see alignment E=1.4e-152 PF00109: ketoacyl-synt" amino acids 80 to 118 (39 residues), 27.4 bits, see alignment 3.7e-10 PF02803: Thiolase_C" amino acids 271 to 392 (122 residues), 180.2 bits, see alignment E=1.7e-57

Best Hits

Swiss-Prot: 88% identical to ATOB_PSEAE: Acetyl-CoA acetyltransferase (atoB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00626, acetyl-CoA C-acetyltransferase [EC: 2.3.1.9] (inferred from 98% identity to pfs:PFLU2150)

MetaCyc: 100% identical to acetyl-CoA C-acetyltransferase (Pseudomonas simiae)
Acetyl-CoA C-acyltransferase. [EC: 2.3.1.16, 2.3.1.9]

Predicted SEED Role

"Acetyl-CoA acetyltransferase (EC 2.3.1.9)" in subsystem Acetyl-CoA fermentation to Butyrate or Archaeal lipids or Butanol Biosynthesis or Isoprenoid Biosynthesis or MLST or Polyhydroxybutyrate metabolism or Serine-glyoxylate cycle (EC 2.3.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.16, 2.3.1.9

Use Curated BLAST to search for 2.3.1.16 or 2.3.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U0F8 at UniProt or InterPro

Protein Sequence (393 amino acids)

>PS417_10515 acetyl-CoA acetyltransferase (Pseudomonas simiae WCS417)
MQDVVIVAATRTAVGSFQGSLASIPAPELGAAVIRRLLEQTGLDPAQVDEVILGQVLTAG
SGQNPARQASILAGLPHAVPSLTLNKVCGSGLKALHLGAQAIRCGDAEVIIAGGMENMSL
APYVLPAARTGLRMGHAKMIDSMITDGLWDAFNDYHMGITAENLVDKYGISREAQDAFAA
ASQQKATAAIEAGRFVDEITPILIPQRKGDPVAFAVDEQPRAGTTAESLAKLKPAFKKDG
SVTAGNASSLNDGAAAVLLMSADKAKALGLPVLARIASYANAGVDPAIMGIGPVSATRRC
LDKAGWSLGDLDLIEANEAFAAQSLAVGKELEWDAEKVNVNGGAIAIGHPIGASGCRVLV
TLLHEMIKRDAKKGLATLCIGGGQGVALALERS