Protein Info for GFF2061 in Xanthobacter sp. DMC5

Annotation: Formate hydrogenlyase subunit 5

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 PF00329: Complex1_30kDa" amino acids 60 to 122 (63 residues), 30.2 bits, see alignment E=8.9e-11 PF00374: NiFeSe_Hases" amino acids 185 to 250 (66 residues), 29.6 bits, see alignment E=5.4e-11 PF00346: Complex1_49kDa" amino acids 271 to 424 (154 residues), 116.2 bits, see alignment E=2.2e-37 amino acids 431 to 499 (69 residues), 27.6 bits, see alignment E=2.3e-10

Best Hits

KEGG orthology group: None (inferred from 78% identity to xau:Xaut_0170)

Predicted SEED Role

"Formate hydrogenlyase subunit 5" in subsystem Formate hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (500 amino acids)

>GFF2061 Formate hydrogenlyase subunit 5 (Xanthobacter sp. DMC5)
MVNLSDLFARNGSTCRPWPRVSVNEAEWNGLCAELAAGRLTLSALFGDSGAVHMALLEEE
TGRLALATLPCPTGAFPSVARHHPPAARLERTIRDLFGLTPVGAPDLRPWLDHARWGVRA
PLGAAIPDAGAGEAYPVLPVEGEGLHQIPVGPVHAGIIEPGHFRFSAYGETVVRLEERLG
YVHKGTEGLMAGRTPEEAARIAGRHSGDATVAYALAFCRAVEAARGVAVPERAHALRGLM
AELERLANHLGDIGAICNDAAFAIMLAHCGVLRERVLRASARAFGHRLMMDRVVPGGVAQ
DIPAEAIAGVKAMVAEVRRAFPALVRLYDETASLQDRTVGTGFTKPDYVRTFGTGGFVGR
ASGRGFDARRALPYPPYDRLPFEVPVRADGDVNARVWVRIREVEESLGLIIRLLDTLPKG
DILAPVPAGGGEGVALVESFRGDVFAFVALEGDGRVRRAHLRDPSWFQWPLLETAIEGNI
VADFPLCNKSFNCSYSGVDL