Protein Info for PS417_10510 in Pseudomonas simiae WCS417

Annotation: esterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 138 PF13622: 4HBT_3" amino acids 49 to 133 (85 residues), 38.4 bits, see alignment E=1.2e-13 PF03061: 4HBT" amino acids 50 to 119 (70 residues), 49.6 bits, see alignment E=4e-17

Best Hits

Swiss-Prot: 55% identical to Y474_PSEAE: Putative esterase PA0474 (PA0474) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 78% identity to pfl:PFL_2301)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1TTM5 at UniProt or InterPro

Protein Sequence (138 amino acids)

>PS417_10510 esterase (Pseudomonas simiae WCS417)
MITHVVPEGFVSLPRSSPLLDLLGPAYCRGEGLQLEIGLRADNRHANGRGTVHGGVLATL
ADIGMGYAMAFSSEPPLPLTTASMTLDYLGAVQVGEWIVVRLEHHKRGRQMAFATVSLQV
GEKVVARASAVFAVPRSD