Protein Info for GFF2058 in Xanthobacter sp. DMC5

Annotation: Formate hydrogenlyase subunit 4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 69 to 93 (25 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details amino acids 133 to 155 (23 residues), see Phobius details amino acids 162 to 188 (27 residues), see Phobius details amino acids 228 to 248 (21 residues), see Phobius details amino acids 255 to 279 (25 residues), see Phobius details amino acids 291 to 312 (22 residues), see Phobius details PF00146: NADHdh" amino acids 13 to 304 (292 residues), 132.8 bits, see alignment E=8.7e-43

Best Hits

KEGG orthology group: None (inferred from 90% identity to xau:Xaut_0167)

Predicted SEED Role

"Formate hydrogenlyase subunit 4" in subsystem Formate hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (315 amino acids)

>GFF2058 Formate hydrogenlyase subunit 4 (Xanthobacter sp. DMC5)
MMANLLVQGTQMLLVLALAPLLTGLVRKVKARLTRRRGASVFQPYRDLARLLNKEAVLAH
NASWLFRAVPYLLFAATWVAAALVPTFGTGLIFSWSADLIVITALLGSARFFLALAGMDV
GTSFGGIGSSREVMISSLAEPAMIMIVFSLALVAHSTQLSTIASVMVAGVGLRVSLALAL
VALAIVAVAENGRIPVDNPATHLELTMVHEAMVLEYSGRHLALIELAAQLKLLLFISLVA
CVFLPWGLAPAGAGAGAVLLGMASYGAKLAAGAVLLAVFETSIAKMRVFRVPDFLGAALM
LGLLGTLLLFVSRIL