Protein Info for GFF2058 in Pseudomonas sp. DMC3

Annotation: Phosphatidate cytidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 28 to 44 (17 residues), see Phobius details amino acids 54 to 72 (19 residues), see Phobius details amino acids 78 to 95 (18 residues), see Phobius details amino acids 107 to 125 (19 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 176 to 194 (19 residues), see Phobius details amino acids 206 to 224 (19 residues), see Phobius details amino acids 247 to 267 (21 residues), see Phobius details PF01148: CTP_transf_1" amino acids 3 to 264 (262 residues), 222.9 bits, see alignment E=3.5e-70

Best Hits

Swiss-Prot: 73% identical to CDSA_PSEAE: Phosphatidate cytidylyltransferase (cdsA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00981, phosphatidate cytidylyltransferase [EC: 2.7.7.41] (inferred from 92% identity to pfo:Pfl01_1106)

Predicted SEED Role

"Phosphatidate cytidylyltransferase (EC 2.7.7.41)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.7.41)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (268 amino acids)

>GFF2058 Phosphatidate cytidylyltransferase (Pseudomonas sp. DMC3)
MLKQRIITALILLPIALCGFFLLKGAGFALFIGLVVSLGAWEWARLAGFTAQSFRVGFAA
VVALMLFVMYVLPGLAPWVLGASVIWWAIATYLVLTYPRSSAHWSTAATKLLIGLLILLP
AWQGLVQIKQYPLGNWLIMAVMVLVWGADIGAYFSGRKFGKRKLAPQVSPGKSWEGVYGG
LALSLVITAIVGLVRDWTVAELFKGLIGAAVIVFISVVGDLTESMFKRQSGIKDSSNLLP
GHGGVLDRIDSLTAAIPVFAVLLWMAAP