Protein Info for GFF2058 in Methylophilus sp. DMC18

Annotation: Homoserine O-succinyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 69% identical to METXS_NITMU: Homoserine O-succinyltransferase (metXS) from Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)

KEGG orthology group: K00641, homoserine O-acetyltransferase [EC: 2.3.1.31] (inferred from 81% identity to mmb:Mmol_2244)

MetaCyc: 46% identical to homoserine O-acetyltransferase (Leptospira meyeri)
Homoserine O-acetyltransferase. [EC: 2.3.1.31]

Predicted SEED Role

"Homoserine O-acetyltransferase (EC 2.3.1.31)" in subsystem Methionine Biosynthesis (EC 2.3.1.31)

MetaCyc Pathways

superpathway of L-methionine biosynthesis (by sulfhydrylation) (11/12 steps found)
L-methionine biosynthesis III (4/4 steps found)
L-homocysteine biosynthesis (2/2 steps found)
superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (6/10 steps found)
superpathway of L-cysteine biosynthesis (fungi) (3/6 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (375 amino acids)

>GFF2058 Homoserine O-succinyltransferase (Methylophilus sp. DMC18)
MFESNSVGIVKAQVAHFTRPLTLKSGAVLPQYHLAYETYGELNAAKSNAVLICHALSGNH
HVAGRYTPEDKYPGWWDNLVGPGKPLDTNKFFVIGLNNLGGCHGSSGPSSVDPLTDKPYS
ATFPVVTVEDWVESQARLLDYLGIDQLAAVIGGSLGGMQALHWNIVYPERVRHAFVIASA
PNLTAQNMAFNEVARQAIITDPEFFDGDYYNHGTVPRRGLRIARMLGHITYLSDDAMGEK
FGRKLRHGDVKYSFDVEFEMESYLRYQGDKFAGEFDANTYLRMTRALDYFDPALDFEGNL
SKALSRAKAKFVVISFTTDWRFSPARSREIVQALLDNALPVKYAEVTSAHGHDAFLMPDP
HYHAIMRAYLEQIKV