Protein Info for GFF2056 in Methylophilus sp. DMC18

Annotation: Release factor glutamine methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 TIGR00536: methyltransferase, HemK family" amino acids 5 to 284 (280 residues), 259 bits, see alignment E=4.4e-81 PF17827: PrmC_N" amino acids 22 to 78 (57 residues), 51.7 bits, see alignment E=6.4e-17 TIGR03534: protein-(glutamine-N5) methyltransferase, release factor-specific" amino acids 28 to 280 (253 residues), 302.7 bits, see alignment E=2.1e-94 PF03602: Cons_hypoth95" amino acids 96 to 199 (104 residues), 24.9 bits, see alignment E=8.8e-09 PF01170: UPF0020" amino acids 103 to 198 (96 residues), 23.9 bits, see alignment E=1.9e-08 PF06325: PrmA" amino acids 107 to 192 (86 residues), 34.4 bits, see alignment E=1.1e-11 PF10294: Methyltransf_16" amino acids 112 to 161 (50 residues), 26.4 bits, see alignment 3.2e-09 PF13489: Methyltransf_23" amino acids 116 to 261 (146 residues), 27.2 bits, see alignment E=1.8e-09 PF13847: Methyltransf_31" amino acids 120 to 249 (130 residues), 57.1 bits, see alignment E=1.1e-18 PF05175: MTS" amino acids 120 to 199 (80 residues), 63.5 bits, see alignment E=1.1e-20 PF13649: Methyltransf_25" amino acids 122 to 192 (71 residues), 46.6 bits, see alignment E=2.7e-15 PF08241: Methyltransf_11" amino acids 123 to 177 (55 residues), 29.7 bits, see alignment E=4.9e-10

Best Hits

Swiss-Prot: 49% identical to PRMC_XANCP: Release factor glutamine methyltransferase (prmC) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K02493, methyltransferase [EC: 2.1.1.-] (inferred from 55% identity to mfa:Mfla_2476)

MetaCyc: 47% identical to protein-(glutamine-N5) methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-14992 [EC: 2.1.1.297]

Predicted SEED Role

"Protein-N(5)-glutamine methyltransferase PrmC, methylates polypeptide chain release factors RF1 and RF2"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.297

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>GFF2056 Release factor glutamine methyltransferase (Methylophilus sp. DMC18)
MLPTIRACLDAAKIQLMQTIPADEASIEARMLLMEVLKVNHAWLLGHALDLLDTQKQADF
KVLIDRRLKGEPIAHILGYREFFGLALRVTPDTLIPRPDTETLVEAALEKINQHARGKPL
EVLDLGTGTGAIALALAKHGPDCQVTAVDASEAALAVAKDNAYALGIENTQFVLSDWFSA
LAPKPYHVIVSNPPYIEADDPHLQQGDLRFEPLSALASGADGLQAIRQIIAQAPGYLTEN
GWLMLEHGYNQADAVQSLLKAYRFTEIVTVRDLGNQPRVTSGKWPLAKPV