Protein Info for GFF2054 in Variovorax sp. SCN45

Annotation: RNA binding methyltransferase FtsJ like

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 transmembrane" amino acids 161 to 178 (18 residues), see Phobius details PF01728: FtsJ" amino acids 64 to 249 (186 residues), 141 bits, see alignment E=2.1e-45

Best Hits

KEGG orthology group: K06442, putative hemolysin (inferred from 89% identity to vap:Vapar_4682)

Predicted SEED Role

"RNA binding methyltransferase FtsJ like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (258 amino acids)

>GFF2054 RNA binding methyltransferase FtsJ like (Variovorax sp. SCN45)
MRADQLLVERGLAASRSQAVRLIAGGMRWRDAGTSDAWRNVAKNKDEVPESAELELVDAA
EARYVSRGGLKLEGALAASGVDPAGKLCLDVGQSTGGFTDCLLQRGAAKVVGVDVGHGQL
HAKLREDERVVPIEGVNARALSPDDLGDEGESRFDLIVGDLSFISLTLVLPAVVEFLADD
GRLLMLVKPQFELQPGQVGKGGIVRDESMYAVVEKRLYDACEALGLKVLQWFDSPIAGGD
GNREFFIHAVRAVHANGS