Protein Info for PS417_10435 in Pseudomonas simiae WCS417

Annotation: serine/threonine protein kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 47 to 70 (24 residues), see Phobius details amino acids 82 to 104 (23 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 181 to 204 (24 residues), see Phobius details amino acids 213 to 238 (26 residues), see Phobius details amino acids 291 to 319 (29 residues), see Phobius details amino acids 325 to 350 (26 residues), see Phobius details amino acids 356 to 377 (22 residues), see Phobius details PF00375: SDF" amino acids 16 to 395 (380 residues), 214.4 bits, see alignment E=1.4e-67

Best Hits

Swiss-Prot: 90% identical to SSTT_PSEPF: Serine/threonine transporter SstT (sstT) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K07862, serine/threonine transporter (inferred from 98% identity to pfs:PFLU2139)

MetaCyc: 71% identical to serine/threonine:Na+ symporter (Escherichia coli K-12 substr. MG1655)
RXN-22449; RXN0-4083

Predicted SEED Role

"Sodium:dicarboxylate symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UA90 at UniProt or InterPro

Protein Sequence (406 amino acids)

>PS417_10435 serine/threonine protein kinase (Pseudomonas simiae WCS417)
MTAAPSLLQRLARVSLVTQIVIGLIAGILLALLLPEAAKATGFIGKVFVTALKAVAPILV
FVLVMASIANHKHGQETHIKPILFLYLLGTFAAAVVAVIASMWFPSSLVLATHDATVSAP
GGIGEVLQSLLLSVVDNPVSALMNANFIGILAWAIGMGVAIRHAGETTRTLLDDLSNGVT
LIVRVVIRFAPLGIFGLVASTLATSGFGALLGYAHLLVVLIGCMLFVALVVNPAIVFWKL
RRNPYPLVLMCLRESGITAFFTRSSAANIPVNLALSKRLGLHEDTYSVSIPLGATINMAG
AAITITVLTLAAVHTLGIAVDLPTAVLLSVVAAICACGASGVAGGSLLLIPLACSLFGIP
SDIAMQVVAVGFIIGVLQDSAETALNSSTDVLFTAAACLGKEEQPA