Protein Info for GFF2043 in Variovorax sp. SCN45

Annotation: Efflux ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 transmembrane" amino acids 28 to 53 (26 residues), see Phobius details amino acids 64 to 83 (20 residues), see Phobius details amino acids 124 to 148 (25 residues), see Phobius details amino acids 154 to 181 (28 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details amino acids 243 to 263 (21 residues), see Phobius details

Best Hits

KEGG orthology group: K01992, ABC-2 type transport system permease protein (inferred from 80% identity to vap:Vapar_4688)

Predicted SEED Role

"FIG00761799: membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (279 amino acids)

>GFF2043 Efflux ABC transporter, permease protein (Variovorax sp. SCN45)
VTALRELARPYIAAFASRFLQMLQYRTAALAGFGTQCWWGGIKVMVLAAFYGGASMAGTP
MSLTQAITYSWLSQGLLVLVPWLGDPEVAQAVRTGAVAYDRLRPVDAYALWFARSAGWIA
ARVLPRVALMAAFAAVALPLVGLGDWAWKPPASFAAAIAFLASSVLALLLSTSMVMLLNI
AATAALNERGINALAGPVVIVFSGNLLPLMLLPNAWQTALLLQPFAGVVDIPARIYFGLM
SGWQAMAGLGLQSFWIVVLVVFGRMAMQRTMRRLEVQGG