Protein Info for GFF2043 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Sulfate transporter, CysZ-type

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 transmembrane" amino acids 65 to 85 (21 residues), see Phobius details amino acids 105 to 126 (22 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 202 to 221 (20 residues), see Phobius details amino acids 243 to 268 (26 residues), see Phobius details PF07264: EI24" amino acids 49 to 265 (217 residues), 207.7 bits, see alignment E=9.6e-66

Best Hits

Swiss-Prot: 100% identical to CYSZ_SALTY: Sulfate transporter CysZ (cysZ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K06203, CysZ protein (inferred from 99% identity to sei:SPC_1231)

MetaCyc: 90% identical to sulfate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-586

Predicted SEED Role

"Sulfate transporter, CysZ-type" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (287 amino acids)

>GFF2043 Sulfate transporter, CysZ-type (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
LLFFRTFPNYPPSDNRVRYPTFTQGFKKKEYVLNMVSSSTTVPRSGVYYFSQGWKLVTLP
GIRRFVILPLLVNIVLMGGAFWWLFTQLDAWIPSLMSHVPDWLQWLSYLLWPIAVISVLL
VFGYFFSTLANWIAAPFNGLLAEQLEARLTGATPPDTGILGIMKDVPRIMKREWQKLAWY
LPRAIVLLILYFIPGIGQTIAPVLWFLFSAWMLAIQYCDYPFDNHKVPFKTMRAALRTQK
VANMQFGALTSLFTMIPVLNLFIMPVAVCGATAMWVDCWRAKHALWK