Protein Info for GFF2042 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 signal peptide" amino acids 12 to 19 (8 residues), see Phobius details amino acids 36 to 38 (3 residues), see Phobius details transmembrane" amino acids 20 to 35 (16 residues), see Phobius details amino acids 285 to 305 (21 residues), see Phobius details PF02646: RmuC" amino acids 97 to 373 (277 residues), 175.3 bits, see alignment E=7.7e-56

Best Hits

KEGG orthology group: K09760, DNA recombination protein RmuC (inferred from 87% identity to xau:Xaut_3306)

Predicted SEED Role

"DNA recombination protein RmuC" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (384 amino acids)

>GFF2042 hypothetical protein (Xanthobacter sp. DMC5)
MPVVLFTFGGRPFTVAEAAAVAAAVLALLLFLVLVSLVRQSRARAAVVAEEALRRDEMDR
RLRELVRVQSETAGRVQSMTEILAQRQSELARAVSDRLDQTSHRLGETLSTAARATHESL
TRIAERLVMVETAERTLGDLSAQVVSLRETLANKQARGAFGQARMEAIVADGLPRGSFAF
QYTLSNGKRPDCAIFLPGDPRPLLVDSKFPLEAVTAFREAPSAEHRKAAGQRLRNDLLKH
VYDVAERYFIPGETQDVALIFVPSESVYAEISEHFDAVVQEAYRLRVVLVSPSLLMLAVQ
VVQAIAKDARMREEADRVRAEVAALVGDVSRLRERVGDLAKHFSQVGDDVQRVIISADKI
ARRGLRLEQLDFDTPGPAPAAPPE