Protein Info for GFF2040 in Xanthobacter sp. DMC5

Annotation: Formamidopyrimidine-DNA glycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 PF01149: Fapy_DNA_glyco" amino acids 1 to 127 (127 residues), 129.5 bits, see alignment E=1.5e-41 TIGR00577: DNA-formamidopyrimidine glycosylase" amino acids 1 to 291 (291 residues), 279 bits, see alignment E=2e-87 PF06831: H2TH" amino acids 144 to 240 (97 residues), 89.7 bits, see alignment E=1.5e-29 PF06827: zf-FPG_IleRS" amino acids 262 to 291 (30 residues), 27.6 bits, see alignment (E = 3.2e-10)

Best Hits

Swiss-Prot: 85% identical to FPG_XANP2: Formamidopyrimidine-DNA glycosylase (mutM) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K10563, formamidopyrimidine-DNA glycosylase [EC: 3.2.2.23 4.2.99.18] (inferred from 85% identity to xau:Xaut_3307)

Predicted SEED Role

"Formamidopyrimidine-DNA glycosylase (EC 3.2.2.23)" in subsystem DNA Repair Base Excision (EC 3.2.2.23)

Isozymes

Compare fitness of predicted isozymes for: 4.2.99.18

Use Curated BLAST to search for 3.2.2.23 or 4.2.99.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (292 amino acids)

>GFF2040 Formamidopyrimidine-DNA glycosylase (Xanthobacter sp. DMC5)
MPELPEVETVRRGLMPVLQGAVIESAEARRPDLRWPLPENFAERLAGRRVEAIGRRAKYL
LADLDGGEVMILHLGMSGSIRVEGTETRRPGAFHYPRAAAGPHDHVVLHLAGGTTVTFND
PRRFGAILIVPYDRLESHPLLAGLGPEPLGNAFHADYLASAFARRNTALKAALLDQKLVA
GLGNIYVCEALFRAGLSPRRLAHTIVTKDGKPTPRVERLVTAIRDVLREAIQAGGSSLRD
HKQVSGELGYFQHTFRVYGREGEPCRTRHCRGIVQRIVQAGRSTFYCPVCQR