Protein Info for GFF2038 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Gamma-glutamyl-GABA hydrolase (EC 3.5.1.94)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 PF07722: Peptidase_C26" amino acids 22 to 227 (206 residues), 213 bits, see alignment E=4.7e-67 PF00117: GATase" amino acids 61 to 229 (169 residues), 41.5 bits, see alignment E=1.2e-14

Best Hits

Swiss-Prot: 40% identical to PUUD_ECO57: Gamma-glutamyl-gamma-aminobutyrate hydrolase (puuD) from Escherichia coli O157:H7

KEGG orthology group: K07010, putative glutamine amidotransferase (inferred from 71% identity to pna:Pnap_2865)

MetaCyc: 39% identical to gamma-glutamyl-gamma-aminobutyrate hydrolase (Escherichia coli K-12 substr. MG1655)
Gamma-glutamyl-gamma-aminobutyrate hydrolase. [EC: 3.5.1.94]

Predicted SEED Role

"Gamma-glutamyl-GABA hydrolase (EC 3.5.1.94)" (EC 3.5.1.94)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.94

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (269 amino acids)

>GFF2038 Gamma-glutamyl-GABA hydrolase (EC 3.5.1.94) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNKPPCMVWLPADHRLMGDHGHQMPFLLLGDKYARAVKVGAQAQPVMFPLADTGQISELL
ALVDGVMLTGSPSNVHPSHFNEDVADPSLPLDADRDLLTLALVKACVHEGVPLLGICRGF
QEINVALGGTLHQRVHEVPGMMDHREPKIAPPDEQYAPRHAIRFAPGSVFEEWAGGPEAQ
VNSLHGQGINRLAAGLDALAHAPDGLVEAFGVRGARTFAYAVQFHPEWRCWETPFYAAIF
DAFGRACRQRMNLRLQHADLARSAASASA