Protein Info for GFF2034 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13416: SBP_bac_8" amino acids 52 to 302 (251 residues), 144.2 bits, see alignment E=1.1e-45 PF01547: SBP_bac_1" amino acids 53 to 280 (228 residues), 46.9 bits, see alignment E=5.8e-16 PF13343: SBP_bac_6" amino acids 93 to 287 (195 residues), 33.6 bits, see alignment E=4.3e-12

Best Hits

KEGG orthology group: K02055, putative spermidine/putrescine transport system substrate-binding protein (inferred from 80% identity to ara:Arad_7051)

Predicted SEED Role

"ABC transporter, periplasmic spermidine putrescine-binding protein PotD (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (345 amino acids)

>GFF2034 hypothetical protein (Xanthobacter sp. DMC5)
MRFSVSIPVMTAALALSVATASAEQITFVSQGGAYQEAQTKAILNPAAKLLGITINQDSA
PDAWPVLKTQAATGKPIWDVIDAPTTICVRGGDQGMVEKLDFSKIPTAASMPAQYKTPYS
VAYEFYSSVLAYNKKKFASKAPQTWADFWDVKAFPGTRALRNHPQATMEAALLADGVPAD
KLYPLDVDRAFKKLEQIKPHITVWWTSGAQSAQLLADGEVDMEMAWNGRVAAVMKEGAPV
SFTFNQGLLQETSLCIVKGAPNLETAYKFVNAAMTPDIQANFPAYIDYGPGNPAAYATGK
ISPERATQMPSAPENAAKQVLVSQAWWASPAGEDAIKRWAGFVQK