Protein Info for PS417_10375 in Pseudomonas simiae WCS417

Annotation: chemotaxis protein CheY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 PF00072: Response_reg" amino acids 7 to 118 (112 residues), 108.3 bits, see alignment E=2.4e-35 PF00486: Trans_reg_C" amino acids 160 to 235 (76 residues), 72.4 bits, see alignment E=2.6e-24

Best Hits

Swiss-Prot: 40% identical to VIRG_RHIRD: Regulatory protein VirG (virG) from Rhizobium radiobacter

KEGG orthology group: None (inferred from 89% identity to pba:PSEBR_a3218)

Predicted SEED Role

"Transcriptional regulatory protein ompR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UJE0 at UniProt or InterPro

Protein Sequence (246 amino acids)

>PS417_10375 chemotaxis protein CheY (Pseudomonas simiae WCS417)
MDHIDHIMIVDDDREIRELVGNYLKKNGLRTTVAADGRQMRALLDSTAVDLIVLDIMMPG
DDGLVLCRELRAGKHKATPILMLTARNDETDRIIGLEMGADDYLVKPFAARELLARINAV
LRRTRSLPPNLVVSEASRLLAFGKWRLDTTARHLMDAQGTVVNLSGGEYRLLRVFVDHPQ
RVLSRDQLLNLTQGRDADLFDRSIDLLVSRLRQRLLDDARDPAYVKTVRSEGYVFTYPVE
ILGEAS