Protein Info for GFF2034 in Sphingobium sp. HT1-2

Annotation: Glycogen synthase, ADP-glucose transglucosylase (EC 2.4.1.21)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 481 TIGR02095: glycogen/starch synthase, ADP-glucose type" amino acids 1 to 475 (475 residues), 538.1 bits, see alignment E=9.3e-166 PF08323: Glyco_transf_5" amino acids 2 to 235 (234 residues), 238 bits, see alignment E=2.5e-74 PF13439: Glyco_transf_4" amino acids 123 to 251 (129 residues), 31.9 bits, see alignment E=2.7e-11 PF00534: Glycos_transf_1" amino acids 285 to 445 (161 residues), 41.8 bits, see alignment E=1.8e-14 PF13692: Glyco_trans_1_4" amino acids 292 to 437 (146 residues), 36.6 bits, see alignment E=1.1e-12

Best Hits

Swiss-Prot: 63% identical to GLGA_RHILO: Glycogen synthase (glgA) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K00703, starch synthase [EC: 2.4.1.21] (inferred from 82% identity to sjp:SJA_C1-21940)

Predicted SEED Role

"Glycogen synthase, ADP-glucose transglucosylase (EC 2.4.1.21)" in subsystem Glycogen metabolism (EC 2.4.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (481 amino acids)

>GFF2034 Glycogen synthase, ADP-glucose transglucosylase (EC 2.4.1.21) (Sphingobium sp. HT1-2)
MKLLSVASEIYPLIKTGGLADVVGALPGALAGHDVETRTLVPGYPSVLSKLGKAKAVRRY
DKLFGAPATVLAGKVGDLDLLVLDAPDFFAREGGPYGDHGGNDWGDNWRRFAALARVGAD
IAAEGVKGWVPDIVHVHDWQAAMTAAYMRFGPAHAVPRVVTIHNLAFQGRFGPEIFAQLG
LPAEAWGMDGVEYYGGTGFLKAGLVSADAITTVSPTYAEEIRSPVHGMGLDGLINGRSDK
LHGILNGVDTDIWNPAEDELIARRYSARALSGRGANRRALEKRFGLQRDDAPIFVIISRL
TWQKGMDLMMNAIDHLVGLGAKLAVLGSGDHALEGGFLAAADRHRGRVGVQIGYDEPLSH
LLQAGGDAILIPSRFEPCGLTQLYGLRYGCVPVVARVGGLADTVIDANEAAVSAGVATGI
LFAGDDPLALHGAIARTVRLHGEPEAWQAMQRAGMRADFSWTHSAARYAALYRSLLEREA
A