Protein Info for GFF2033 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 74 to 96 (23 residues), see Phobius details amino acids 105 to 128 (24 residues), see Phobius details amino acids 157 to 177 (21 residues), see Phobius details amino acids 200 to 229 (30 residues), see Phobius details amino acids 257 to 281 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 89 to 281 (193 residues), 38.9 bits, see alignment E=3.8e-14

Best Hits

KEGG orthology group: K02054, putative spermidine/putrescine transport system permease protein (inferred from 79% identity to ara:Arad_7050)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component PotB (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>GFF2033 hypothetical protein (Xanthobacter sp. DMC5)
MSASSSDPSVVHKRQEQRLVLLLLAPSLAVVGCLLIVPLCWLVWQSVRQDGAFTLAHYAR
FFSDAVYWTTFLQTFRIAFIVTAVTVLLGYPIAYVAAGASRRWSIFILAMVILPFWTSVL
VRAYAWLILLQRRGLVNSVLTDFGLIQNPLALVNNELGTVIATVHILLPFMVLPLYATMQ
KIPAELTMAGASLGGTPFYVFTRVFLPLSLPGVVAGMVLVFVLTLGFYITPELLGGGRTY
MVSMLVSRNIEVYNEWGAASSISIVLLACVFLVFRLASLIIPFERIMGAR