Protein Info for GFF2033 in Sphingobium sp. HT1-2

Annotation: Limit dextrin alpha-1,6-maltotetraose-hydrolase (EC 3.2.1.196)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 634 PF02922: CBM_48" amino acids 6 to 91 (86 residues), 56.6 bits, see alignment E=2.6e-19 TIGR02100: glycogen debranching enzyme GlgX" amino acids 7 to 586 (580 residues), 743.9 bits, see alignment E=7e-228 PF00128: Alpha-amylase" amino acids 175 to 257 (83 residues), 22.5 bits, see alignment E=6.3e-09

Best Hits

KEGG orthology group: K02438, glycogen operon protein GlgX [EC: 3.2.1.-] (inferred from 76% identity to sjp:SJA_C1-21930)

Predicted SEED Role

"Glycogen debranching enzyme (EC 3.2.1.-)" in subsystem Glycogen metabolism or Trehalose Biosynthesis (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (634 amino acids)

>GFF2033 Limit dextrin alpha-1,6-maltotetraose-hydrolase (EC 3.2.1.196) (Sphingobium sp. HT1-2)
MSAGGFGPVIDAGGTRFAVWAPEATQLWLCLFDADDRETRLPMARGGEGVWQVHAPGVGA
GRRYGLRADGPYDPDHGLWFDPDKLLLDPYAPAIDRAFVHDPMLAAPRGQGEDTAPLMPK
GVVVAPLPAIAPAPPCFQSGGLIYELQVRSFSLLHPDVPEAQRGTIAALAHPAVIDHLQK
LGVGAVELMPINAWIDERHLPPLGLRNAWGYNPVSYFALDPRLAPGGLTELRDTVAALHD
AGIGVILDMVYNHDGESDRLGPTLSLRGLNARAYFRHEADGRLINDTGTGNSVDCNQPMV
RRMILESLRHFVVQAGIDGFRFDLAPALGRLPDGFDRDAPLLAKMRTDPVLGDRILIAEP
WDIGPGGYQLGRFGPPWLEWNDRYRDDMRRFWRGDAGTIGAFATRLAGSSDIFEGITRSV
NFLAAHDGFTLADCTAYADKHNLANGEDNRDGHGENFSWNNGVEGASDDPTVIAARRRDI
KALLSTLFCSRGTIMLTAGDEFGRSQMGNNNAYAQDNGISWIEWDARDREIEAHAFALGQ
WRRRCAELTDVALLGEGDVVWLDEGGQPLSVAQWEDPARRRLVLHFRASGLSLCINGAEG
DFLFDLPDGPLMVPGRSMMPQRRSVIPEGATAPD