Protein Info for GFF203 in Xanthobacter sp. DMC5

Annotation: Serine acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 PF06426: SATase_N" amino acids 33 to 137 (105 residues), 116.4 bits, see alignment E=7.4e-38 TIGR01172: serine O-acetyltransferase" amino acids 106 to 266 (161 residues), 225.7 bits, see alignment E=1.6e-71 PF00132: Hexapep" amino acids 217 to 251 (35 residues), 29.3 bits, see alignment 5e-11

Best Hits

Swiss-Prot: 52% identical to CYSE_SALTY: Serine acetyltransferase (cysE) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00640, serine O-acetyltransferase [EC: 2.3.1.30] (inferred from 84% identity to xau:Xaut_3208)

MetaCyc: 51% identical to serine acetyltransferase (Escherichia coli K-12 substr. MG1655)
Serine O-acetyltransferase. [EC: 2.3.1.30]

Predicted SEED Role

"Serine acetyltransferase (EC 2.3.1.30)" in subsystem Conserved gene cluster possibly involved in RNA metabolism or Cysteine Biosynthesis or Methionine Biosynthesis (EC 2.3.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.30

Use Curated BLAST to search for 2.3.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (294 amino acids)

>GFF203 Serine acetyltransferase (Xanthobacter sp. DMC5)
MPQVPMVSQMPELAVPRVTRLGTERWHDVVDPVWARLRNEAEEAAEREPLLAGFFTSAIL
GQPSLEAVIGERIAARLGDTDLPGSAIRAAWLDAVARDKDISQALRADVMAVVDRDPAAD
RTLEPVLYFKGFHAIQSHRLAHSLWGNGHKDFALYLQSRASSVFAVDIHPQVPMGRGVFF
DHATGIVIGATAVIEDDVSILQGVTLGGTGKESGDRHPKIRRGVLIGAGAKVLGNIEVGR
CARVAAGSVVLKPVPRNSTVAGIPAKVVGEAGCAEPARSMDQMFEDNIWSGADI