Protein Info for GFF2026 in Sphingobium sp. HT1-2

Annotation: Glucose-methanol-choline (GMC) oxidoreductase:NAD binding site

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 541 PF01266: DAO" amino acids 17 to 227 (211 residues), 59.1 bits, see alignment E=1.8e-19 PF00732: GMC_oxred_N" amino acids 182 to 253 (72 residues), 31.1 bits, see alignment E=6.2e-11 PF05199: GMC_oxred_C" amino acids 380 to 513 (134 residues), 89.2 bits, see alignment E=1.2e-28

Best Hits

Predicted SEED Role

"Glucose-methanol-choline (GMC) oxidoreductase:NAD binding site" in subsystem Respiratory dehydrogenases 1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (541 amino acids)

>GFF2026 Glucose-methanol-choline (GMC) oxidoreductase:NAD binding site (Sphingobium sp. HT1-2)
MSIDLSQQTGALRRRADVCVIGAGAAGITTARRLLAAGHQVLLLESGGLDYERETADLNA
GKNVGQTYYDLDDARLRFFGGTTAIWGGRCATLDPIDLQRRDWVAGSGWPLSWDELQDYY
GQARGIFEIGDEPASADALSAHGVPLPGFDRSELHMPVWNFDPRFNRFTFDACQDLRDHP
RCEIITHASVTRIVTRDGAISRIEAKALAGAHLHVEARAFVLAAGGIENARLLLASNIGN
ERDQVGRHFMEHPHARGGRIVDAKAWPLLKAFGRRHRISGHDMAALITPSADLQQREGLL
NSSLTIVGRQPARASQFWGMRAYGSLKHDMSPTRSGRRLWMMTKKAATWAQRHVDPLRPW
LLHKAGKLEIALLVRAEQAPNPDSRVLLTKERDALGVPRVALDWRLSAIDKHSVTGLVDG
LGRELKRLGMGRVERADWLDEPGELWRNDPLISSHAIGGYHHMGTTRMATDPRQGVVDAD
GRVHGQANLYVVGSSIFPTSSWANPTLTIAALALRTADRLSVALNRPVAQPVRVPGLAKA
S