Protein Info for GFF2025 in Xanthobacter sp. DMC5

Annotation: Sensor histidine kinase RegB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 46 to 68 (23 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 101 to 119 (19 residues), see Phobius details amino acids 122 to 141 (20 residues), see Phobius details amino acids 164 to 184 (21 residues), see Phobius details PF02518: HATPase_c" amino acids 326 to 425 (100 residues), 67.6 bits, see alignment E=6.2e-23

Best Hits

KEGG orthology group: K15011, two-component system, sensor histidine kinase RegB [EC: 2.7.13.3] (inferred from 53% identity to mci:Mesci_3722)

Predicted SEED Role

"Sensor histidine kinase PrrB (RegB) (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (435 amino acids)

>GFF2025 Sensor histidine kinase RegB (Xanthobacter sp. DMC5)
MSVTAIESDATRDNLRLLISLRWLAVAGQIAAIGLVHLWLGISLPLAEMGLVVLFLVGLN
LVSLHRALSAVEVTQTELGIELLLDVAALTLQLYLSGGATNPFISLFLLQVILGAVLLAP
PMAWVIVLVTSLSFIWLTHFYRPIDFGTHAGGHHHGERTFFDLHVQGMFLCFILASVLAV
AFVTRITSNLRRRDAHLAEARRRAAEEEHIVRIGLLASGAAHELGTPLATLSVILNDWQH
MPRFRDDPAFTEELAEMQTEIGRCKSIVSHILMVAGEARAEEAQRSPLSDFLDEMVESWV
QSRRPSALDYANATSKGAAITGDGVIQQALFNVLDNALEASPAGISVRAAEEGEDLVIRV
TDQGPGFAPDALAQLGRPFQSSKGEAGRGLGLFLTINVLRKLGGDIEAGNLQGGGAFVEL
RLPLEALAVDYADVA