Protein Info for GFF2023 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 transmembrane" amino acids 16 to 41 (26 residues), see Phobius details amino acids 60 to 83 (24 residues), see Phobius details amino acids 98 to 120 (23 residues), see Phobius details amino acids 140 to 162 (23 residues), see Phobius details amino acids 186 to 209 (24 residues), see Phobius details amino acids 220 to 243 (24 residues), see Phobius details amino acids 269 to 288 (20 residues), see Phobius details amino acids 293 to 313 (21 residues), see Phobius details PF13442: Cytochrome_CBB3" amino acids 382 to 454 (73 residues), 26.8 bits, see alignment E=2.6e-10

Best Hits

Predicted SEED Role

"Cytochrome C553 (soluble cytochrome f)" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (504 amino acids)

>GFF2023 hypothetical protein (Xanthobacter sp. DMC5)
MDFPVFHLDILGNRGLIATIAILHVLINHGLAVGLMPLVAAMEWYGHRRGDPRWDRLAYR
ILFIAFLITTTVGALTGVGIWLSVSLVNPYSIASLIRVFFWAWFVEWLVFITEVCLILAY
TLTWKTWATGAAKVRHIRLGFALAFFSWVTMAIIVSILGFMMDPGNWLSQHTLWSGFTNP
VYLPQLAFRTPLAAAMAGVIAMFLVPFFVKRDDPFRATALRAIAVWTLVAAPLVLAGGLW
YYAVVPEAMRENFGVALASLQFAEWQQRFLEIAVVTVVAILAVVQWAIARPQLLPRVVLI
APFVAILWMTGHFERVREFVRKPYVIGSYMYANGFRVDDYALLQRDGVLAHATYSNPLTD
AEKAGLPEGLAPAERTALLTRIQAGKDVFMNTCSRCHTGHGVNSITGHLQRMFGDQPWKS
ELTAGYIENMHEAQPFMPPFPGNARELELMGAYLEHLQHNSAPIPGAQQAGVVVITPTLR
AALTGAPPLTQASATPLTRETGTR