Protein Info for PS417_10295 in Pseudomonas simiae WCS417

Annotation: chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 559 signal peptide" amino acids 9 to 11 (3 residues), see Phobius details transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 204 to 228 (25 residues), see Phobius details PF08269: dCache_2" amino acids 36 to 199 (164 residues), 79.5 bits, see alignment E=5.2e-26 PF17200: sCache_2" amino acids 51 to 191 (141 residues), 84.9 bits, see alignment E=1.2e-27 PF00672: HAMP" amino acids 225 to 278 (54 residues), 51.3 bits, see alignment 2.4e-17 PF00015: MCPsignal" amino acids 344 to 523 (180 residues), 135.6 bits, see alignment E=3.2e-43

Best Hits

Swiss-Prot: 71% identical to MALCR_PSEAE: Methyl-accepting chemotaxis protein PA2652 (PA2652) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 98% identity to pfs:PFLU2125)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UG28 at UniProt or InterPro

Protein Sequence (559 amino acids)

>PS417_10295 chemotaxis protein (Pseudomonas simiae WCS417)
MRLSLKAKVLSLAVVPVLLFAVVISLTTVWILQGQARNEVEETRQRLLNDAKATLQSYVE
VAMSTIKPLYDAAAPGDTAARAQVVKLLSNTSYGKDGYFFGYDSETIRLFKGNSPDGVGK
SFKDNRDPNGVYVNRDLVKVGKDGTHYLQYSSTQPGQTELVPKMGYTEYLPKWDMVIGTS
VNLDGIEAQVAVVEAKVQKRMEGVLLSILGVAVVLLLVIAAVGMLLANTILRPLHLMKAN
LDDIAAGEGDLTRRLAITSQDELGDLAGAFNRFVDKIHGLVRQITEMTSQLTGLVSQVSD
QAQRSEQAMERQRHETDQVATAINQMSSAAQEVARSAQGASVAAQQTDAEGQAAKRVVDG
SIAQIHALVNDIRSSGVSLDSLQQDVSSIVSVLSVIRSIAEQTNLLALNAAIEAARAGEA
GRGFAVVADEVRALASRTQTSTQEIQGMIDRLQTGTEAAVEAMRRSSDAGDGTSAQANEA
GASLDTMAQLIGTINSMNAQIASAAEEQTAVAEEINRSVHQIAVAVDSVADETQLGAQTS
RSLAELGQRLGQLVGQFRI