Protein Info for GFF2016 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Threonine efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 signal peptide" amino acids 6 to 6 (1 residues), see Phobius details transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 40 to 89 (50 residues), see Phobius details amino acids 111 to 134 (24 residues), see Phobius details amino acids 143 to 172 (30 residues), see Phobius details amino acids 184 to 202 (19 residues), see Phobius details PF01810: LysE" amino acids 17 to 203 (187 residues), 127.6 bits, see alignment E=2.2e-41

Best Hits

KEGG orthology group: None (inferred from 82% identity to ajs:Ajs_0028)

Predicted SEED Role

"Threonine efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (204 amino acids)

>GFF2016 Threonine efflux protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MFGIADYGAFVAAIVLFLLIPGPGNLALITSTSKGGVSGGLAATFGVIAGDQVLMWLAVA
GVAALLAAYPAAFSAVQWLGAAYLAWLGWKMLTAKPGDAPVLNIRPRQYFQQAAVITLLN
PKAIVFYMAFFPLFVDPARHQGLITFGAMAATVAVLTFLYGLVAVLLTHFLAERLRANPV
IGRTLEKLAGVFLIGFGIKLALSK