Protein Info for GFF2015 in Sphingobium sp. HT1-2

Annotation: Glycerol uptake facilitator protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 42 to 63 (22 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 148 to 167 (20 residues), see Phobius details amino acids 179 to 200 (22 residues), see Phobius details amino acids 231 to 253 (23 residues), see Phobius details PF00230: MIP" amino acids 7 to 250 (244 residues), 152.2 bits, see alignment E=9.7e-49 TIGR00861: MIP family channel proteins" amino acids 14 to 250 (237 residues), 188.5 bits, see alignment E=7.3e-60

Best Hits

Swiss-Prot: 42% identical to GLPF_PSEAE: Glycerol uptake facilitator protein (glpF) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02440, glycerol uptake facilitator protein (inferred from 66% identity to xac:XAC0359)

Predicted SEED Role

"Glycerol uptake facilitator protein" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerol fermenation to 1,3-propanediol

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (275 amino acids)

>GFF2015 Glycerol uptake facilitator protein (Sphingobium sp. HT1-2)
VEYRRALIGELISEALAVAIIILIGDGAAAMITLYDPSPYAQAYWGVCIAWGLGVTIAIY
VTGAVSGTHANPAVTLALAFFRGFPKRKILPYWIAQVIGGFIGASLVLQLYHPVIDAYNA
AHGLTRATGGAAGVFFTHPGEHITPIHAFWDEVILTGLLLLGIFAITDEFNDVAPRANSS
ALMIGLLVATIGASAGYLEAWALNPARDFGPRLLAWLAGYDQAAFPSPENYWWVPIAAPL
LGGTLGAGLYQIAVKPYLPSRSKSGAPGDTDMPVK