Protein Info for GFF2013 in Pseudomonas sp. DMC3

Annotation: Protein-glutamate methylesterase/protein-glutamine glutaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 PF00072: Response_reg" amino acids 18 to 131 (114 residues), 69.3 bits, see alignment E=3.1e-23 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 164 to 330 (167 residues), 163.6 bits, see alignment E=1.7e-52 PF00990: GGDEF" amino acids 169 to 329 (161 residues), 167.6 bits, see alignment E=2e-53

Best Hits

KEGG orthology group: K11444, two-component system, chemotaxis family, response regulator WspR [EC: 2.7.7.65] (inferred from 95% identity to pfo:Pfl01_1058)

Predicted SEED Role

"diguanylate cyclase (GGDEF domain) with PAS/PAC sensor"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.65

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>GFF2013 Protein-glutamate methylesterase/protein-glutamine glutaminase (Pseudomonas sp. DMC3)
MNDLQIDDIKTDENAAMVLLVDDQAMIGEAVRRGLSNQENIDFHFCSDPQQAIAQAVRIK
PTVILQDLVMPGLDGLSLVREYRNHPATKDIPIIVLSTKEDPLIKSAAFSAGANDYLVKL
PDTIELVARIRYHSRSYMTLLQRDAAYRALRVSQQQLLDTNLVLQRLMNSDGLTGLSNRR
HFDEYLELEWRRSLRDQTQLSLLMIDVDYFKSYNDSFGHVEGDEALRKVAAAIRDASSRP
SDLPARYGGEEFVLVLPNTSPGGARLLAEKLRQTVAALKIPHNTPAEGSSLTISIGLATM
VPQAGSDCRLLISAADRGLYLAKNNGRNQVGIE