Protein Info for GFF2011 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 transmembrane" amino acids 18 to 43 (26 residues), see Phobius details amino acids 49 to 70 (22 residues), see Phobius details amino acids 94 to 117 (24 residues), see Phobius details amino acids 121 to 122 (2 residues), see Phobius details amino acids 128 to 144 (17 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details amino acids 227 to 251 (25 residues), see Phobius details amino acids 264 to 292 (29 residues), see Phobius details amino acids 323 to 343 (21 residues), see Phobius details amino acids 349 to 370 (22 residues), see Phobius details amino acids 377 to 394 (18 residues), see Phobius details amino acids 399 to 415 (17 residues), see Phobius details PF13520: AA_permease_2" amino acids 15 to 380 (366 residues), 75.5 bits, see alignment E=4.2e-25 PF00324: AA_permease" amino acids 27 to 414 (388 residues), 36.4 bits, see alignment E=2.6e-13

Best Hits

Swiss-Prot: 72% identical to YJEH_ECOLI: L-methionine/branched-chain amino acid exporter YjeH (yjeH) from Escherichia coli (strain K12)

KEGG orthology group: K03294, basic amino acid/polyamine antiporter, APA family (inferred from 99% identity to sew:SeSA_A4598)

MetaCyc: 72% identical to L-methionine/branched chain amino acid exporter (Escherichia coli K-12 substr. MG1655)
RXN0-7050; TRANS-RXN-281; TRANS-RXN-282; TRANS-RXN0-270

Predicted SEED Role

"Putative permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (420 amino acids)

>GFF2011 Putative permease (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MPPDNELMNELKKELGLVQGVILLTTSLLGTGVFALPELAALAAGDISLWAWPLLIILIF
PIAIVFAVLGRHFPHAGGVAHFVGMAFGPRLQRVISWLFLSVIPVSFPAALHIAVGFGQA
LFGWQSEQLLFGELGTLGLLWFMGSRGASSSANLQAIIAGLIIALIAAILWKGAIKPADI
TFPAANEITFSRLCTALAIMFWGFVGIEAFTHLSSEFKNPERDFPRALIIGLMLAGSIYW
TCTAVVLHFGVYSDKIAATASLPLIIVHLFGIQALWIACIIGYLTCFASLNVYAQSFARL
IWTQMQYQPDHYLAQLSPGRLPLHALNVILACCCVSSLVVYALKINLNALIVYANGIFIM
LYLLCMLAGCRLLKGRCYALAVTGCLLCLLLLVMLGWKSLYAIIMLAALWLFLPKRKRMA