Protein Info for GFF2003 in Xanthobacter sp. DMC5

Annotation: 6-hydroxypseudooxynicotine dehydrogenase complex subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 transmembrane" amino acids 28 to 46 (19 residues), see Phobius details amino acids 192 to 213 (22 residues), see Phobius details PF00941: FAD_binding_5" amino acids 5 to 174 (170 residues), 141.7 bits, see alignment E=2.1e-45 PF03450: CO_deh_flav_C" amino acids 181 to 266 (86 residues), 32.1 bits, see alignment E=1e-11

Best Hits

KEGG orthology group: K03519, carbon-monoxide dehydrogenase medium subunit [EC: 1.2.99.2] (inferred from 71% identity to rpc:RPC_0849)

MetaCyc: 51% identical to hmfB (Cupriavidus basilensis)
2-furoyl-CoA dehydrogenase. [EC: 1.3.99.8]

Predicted SEED Role

"Carbon monoxide dehydrogenase medium chain (EC 1.2.99.2)" in subsystem CO Dehydrogenase (EC 1.2.99.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.99.2

Use Curated BLAST to search for 1.2.99.2 or 1.3.99.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (274 amino acids)

>GFF2003 6-hydroxypseudooxynicotine dehydrogenase complex subunit alpha (Xanthobacter sp. DMC5)
MKPAAFDYVRAESVEEALAVLREEGSDARILAGGMSFMAMLNMRLARPKVLVDIMRVAPL
ARMEEEKGALKIGAGVRQARLLAADGLEHAAPLIAKALPFTGHAQTRSRGTVCGSIAHAD
PSAELPLCLVTLKGHVHLKSAKGARTVAADDFFTGMMATAKADDEMIEAVSFPTPKGEGT
AFREIARRHGDFAIVACAALVSATGIRLGVGGVADMPVARDFPLLDGSALDDALNALAWE
LDARDDVHATARYRRELVRRIGRATIEEAKRCCA