Protein Info for GFF2002 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: uncharacterized domain 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 TIGR00369: uncharacterized domain 1" amino acids 21 to 135 (115 residues), 123.2 bits, see alignment E=3e-40 PF03061: 4HBT" amino acids 51 to 128 (78 residues), 63.8 bits, see alignment E=7.5e-22

Best Hits

Swiss-Prot: 51% identical to Y1161_HAEIN: Putative esterase HI_1161 (HI_1161) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 84% identity to pol:Bpro_0114)

MetaCyc: 52% identical to 1,4-dihydroxy-2-naphthoyl-CoA hydrolase (Escherichia coli K-12 substr. MG1655)
RXN-9311 [EC: 3.1.2.28]

Predicted SEED Role

"uncharacterized domain 1"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.2.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (140 amino acids)

>GFF2002 uncharacterized domain 1 (Hydrogenophaga sp. GW460-11-11-14-LB1)
LPIWKKPISVEELTAIHHNTAVQHLGVEFLEVGDDFIRARVPVDTRTKQPYGLLHGGVSV
VLAETLGSCGAAYSCPEGHRAVGLDINANHLKGATSGWVTGVTRPVHIGRTTQVWQIDLT
NDAGELTCVSRITMAVLAPR