Protein Info for GFF2000 in Xanthobacter sp. DMC5

Annotation: Putative aliphatic sulfonates transport permease protein SsuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 45 to 63 (19 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 102 to 122 (21 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 168 to 185 (18 residues), see Phobius details amino acids 192 to 213 (22 residues), see Phobius details amino acids 224 to 243 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 81 to 249 (169 residues), 85.5 bits, see alignment E=2e-28

Best Hits

Swiss-Prot: 37% identical to SSUC_ECOLI: Putative aliphatic sulfonates transport permease protein SsuC (ssuC) from Escherichia coli (strain K12)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 84% identity to rpc:RPC_0846)

MetaCyc: 37% identical to aliphatic sulfonate ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-56-RXN [EC: 7.6.2.14]

Predicted SEED Role

"Hydroxymethylpyrimidine ABC transporter, transmembrane component" in subsystem Thiamin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (256 amino acids)

>GFF2000 Putative aliphatic sulfonates transport permease protein SsuC (Xanthobacter sp. DMC5)
MAKRSGLLGERFIGLLTPLALLGLWEAAARMGLVDARFFPPPSSIVHTFGALVASGELWT
NLLASLRRLFLGMLLGGVPALFLGLAMGISKPLRAAIDPLISATYPIPKSAILPLVLLIF
GLGEMSKVVMVALGAFYPILINTVMGVANIDKIYLDVGHNYRASRWQVFRTIALPGALPS
IMAGVKLAMGMGLILIAISEMVAASDGIGYMIWNAWQVLTVDTMYVGLLVIALLGFVFSV
ILDEIERMLIPWKAKA