Protein Info for GFF2000 in Sphingobium sp. HT1-2

Annotation: 'Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205) / CBS domain' transl_table=11

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00478: IMPDH
  • amino acids 6 to 471 (466 residues), 525.1 bits, E=1.9e-161
• TIGR01302: inosine-5'-monophosphate dehydrogenase
  • amino acids 6 to 453 (448 residues), 621.3 bits, E=5.2e-191
• PF00571: CBS
  • amino acids 91 to 136 (46 residues), 46.4 bits, 1e-15
  • amino acids 147 to 202 (56 residues), 30.5 bits, 9.3e-11
• PF03060: NMO
  • amino acids 252 to 369 (118 residues), 37.7 bits, E=4e-13
• PF01645: Glu_synthase
  • amino acids 256 to 359 (104 residues), 22.2 bits, E=1.9e-08

Best Hits

Swiss-Prot: 66% identical to IMDH_RHITR: Inosine-5'-monophosphate dehydrogenase (guaB) from Rhizobium tropici

KEGG orthology group: K00088, IMP dehydrogenase [EC: 1.1.1.205] (inferred from 95% identity to sch:Sphch_1589)

MetaCyc: 57% identical to inosine 5'-monophosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
IMP dehydrogenase. [EC: 1.1.1.205]

Predicted SEED Role

"Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205)" in subsystem Purine conversions (EC 1.1.1.205)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• adenosine nucleotides degradation I (7/8 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• superpathway of purine nucleotide salvage (11/14 steps found)
• purine nucleotides degradation I (plants) (9/12 steps found)
• inosine 5'-phosphate degradation (3/4 steps found)
• purine nucleotides degradation II (aerobic) (7/11 steps found)
• ureide biosynthesis (3/7 steps found)
• superpathway of purines degradation in plants (9/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.205

Use Curated BLAST to search for 1.1.1.205

Protein Sequence (485 amino acids)

>GFF2000 'Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205) / CBS domain' transl_table=11 (Sphingobium sp. HT1-2)
MDIRLGLTFDDVLLQPAESDVLPSQADTSTHVTKAIKLNIPILSSAMDTVTEADMAIVMA
QLGGIGVLHRNLTVEEQADAVRAVKRFESGMVVNPITILPTATLADAQMLMQRHRISGIP
VVEANGKLVGILTHRDTRFAENPGQPVSELMTKDNLATVKAGVGQDEAMRLLHARRIEKL
LVVDDNYHCVGLITVKDIEKAVTYPQATKDASGRLRVAAASTVGDKGLERSKALIDAECD
LIVIDTAHGHSKQVAVAVEAVKKLSNHVQVVAGNVATAEATKALIDAGADCVKVGIGPGS
ICTTRVVAGVGVPQLTAVMDSANEAHKHGVPVIADGGLRTSGDVAKALAAGAGCVMVGSL
LAGTAEAPGETFLYQGRAYKSYRGMGSVGAMARGSADRYFQADIKDQMKLVPEGIEGQVP
FKGPAKDVIHQLVGGVKAAMGYTGSRTIKDLQERARFVQITNAGLSESHVHDVTITREAP
NYPTR