Protein Info for GFF2000 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Uracil permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 32 to 53 (22 residues), see Phobius details amino acids 59 to 75 (17 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details amino acids 172 to 189 (18 residues), see Phobius details amino acids 196 to 216 (21 residues), see Phobius details amino acids 242 to 261 (20 residues), see Phobius details amino acids 284 to 306 (23 residues), see Phobius details amino acids 318 to 337 (20 residues), see Phobius details amino acids 347 to 371 (25 residues), see Phobius details amino acids 403 to 424 (22 residues), see Phobius details TIGR00801: uracil-xanthine permease" amino acids 25 to 422 (398 residues), 356.6 bits, see alignment E=9.1e-111 PF00860: Xan_ur_permease" amino acids 30 to 399 (370 residues), 304 bits, see alignment E=6.9e-95

Best Hits

Swiss-Prot: 68% identical to RUTG_ECOLI: Putative pyrimidine permease RutG (rutG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 85% identity to dia:Dtpsy_0068)

MetaCyc: 68% identical to pyrimidine:H+ symporter (Escherichia coli K-12 substr. MG1655)
RXN-5076; TRANS-RXN-132; TRANS-RXN-362

Predicted SEED Role

"Uracil permease" in subsystem De Novo Pyrimidine Synthesis or Pyrimidine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (433 amino acids)

>GFF2000 Uracil permease (Hydrogenophaga sp. GW460-11-11-14-LB1)
MGMFNWTEKPATTLANGGVIAPDERLPWPQTAVMGVQHLIAMFGATVLAPILMGFDPNVA
ILMSGIGTLIFFIITGGKVPSYLGSSFAFIGVVIAASGYAGSGPNANIGVALGGIIACGL
VYTLIGLIVQAVGTGWIERFMPPVVTGAVVAVIGLNLAGIPIKNMAPTGFDAWMQGITFV
CVALVAVFTSGMIQRLLILMGLIIASIVYAVLTNGLGMGKPLDLSGIANAAWFGMPNFSA
PVFQMNAMLLIAPVAIILVAENLGHIKAVTAMTGRNLDQYMGRAFIGDGVATMVAGSAGG
TGVTTYAENIGVMAATKIYSTALFLVAGLMAVLLGFSPKFGALIQAIPLAVMGGVSIVVF
GLIAIAGAKIWVDNKVDFSDNKNLLVAAITLILGTGDYTLKFGGFALGGIGTATFGAIIL
YALLNRGKAPSKA