Protein Info for GFF200 in Xanthobacter sp. DMC5

Annotation: Type I secretion system ATP-binding protein PrsD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 610 transmembrane" amino acids 28 to 51 (24 residues), see Phobius details amino acids 63 to 83 (21 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 254 to 272 (19 residues), see Phobius details TIGR01842: type I secretion system ATPase" amino acids 23 to 563 (541 residues), 718.5 bits, see alignment E=2.5e-220 PF00664: ABC_membrane" amino acids 32 to 287 (256 residues), 48.5 bits, see alignment E=1.5e-16 PF00005: ABC_tran" amino acids 355 to 502 (148 residues), 98.8 bits, see alignment E=6.3e-32

Best Hits

Swiss-Prot: 46% identical to APRD_PSEAE: Alkaline protease secretion ATP-binding protein AprD (aprD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 72% identity to xau:Xaut_1510)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (610 amino acids)

>GFF200 Type I secretion system ATP-binding protein PrsD (Xanthobacter sp. DMC5)
MSVTGSREPAASGAPTALDHALRTIRPAFVSVVVFSFFINLLGLNASIYMMQVYDRVLGS
RSIETLVLLTIITAFLYLVWAALEGLRSRLLERAGIAFDTKAAADVFDAVRRMALRAPGN
GQAQALRDLDTVRDFYAGAGLAALCDVPWVPIYMICATLLHPYYGVLAVASCLFSGFLAV
LNNRATRQSLAEAGRAGIKASAIATATLRNAEVLKAMGMSQALRARWNAAHEDAMGWQSR
AGDRGALLIGITKFNRALVQSIVLGLGAWLAIQKQISPGMIIAGSILVGRCIQPIEQAVS
NWKSVVNMRTAYGRIQLLLRAAPPPPERLRLPDPTGTVSVENLFVRAPGREVAVLRQLSF
RLDAGSVLGVIGPTAAGKSTLARALVGVWQAASGAVRLDGSDLAHWDEEQLGRHVGYLPQ
DVELFAGTIAENIARFTAAEPEAVVAAAQLAGVHEMIQQLPQGYNTEIGDGGLALSGGQR
QRIGLARAVFGLPALIVLDEPNASLDPAGEAALTEALKQLKAARRTVVLITHRPAALAQC
DLVLALKDGAALAFGPRDEVMKRVAQGSAPTQMPQPAASAAGGAPTVRVRKSVAGLGAAP
ASSAGPANQP