Protein Info for GFF2 in Xanthobacter sp. DMC5

Annotation: Protein translocase subunit SecE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 65 transmembrane" amino acids 29 to 48 (20 residues), see Phobius details TIGR00964: preprotein translocase, SecE subunit" amino acids 7 to 61 (55 residues), 62.8 bits, see alignment E=1.1e-21 PF00584: SecE" amino acids 8 to 60 (53 residues), 67.1 bits, see alignment E=5.2e-23

Best Hits

Swiss-Prot: 36% identical to SECE_THEMA: Protein translocase subunit SecE (secE) from Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)

KEGG orthology group: K03073, preprotein translocase subunit SecE (inferred from 92% identity to xau:Xaut_3358)

Predicted SEED Role

"Preprotein translocase subunit SecE (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (65 amino acids)

>GFF2 Protein translocase subunit SecE (Xanthobacter sp. DMC5)
MAKNSPMEFYQQVRAETAKVTWPTRRETLITTAMVFVMVFLASIFFLVSDQIIRFGVSTL
LTLGH