Protein Info for GFF1998 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF13379: NMT1_2" amino acids 29 to 254 (226 residues), 74.5 bits, see alignment E=2.5e-24 PF04069: OpuAC" amino acids 30 to 217 (188 residues), 35.2 bits, see alignment E=2.1e-12 PF09084: NMT1" amino acids 46 to 248 (203 residues), 70 bits, see alignment E=5.9e-23 PF16868: NMT1_3" amino acids 127 to 203 (77 residues), 33 bits, see alignment E=1e-11

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 60% identity to rpc:RPC_0844)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (346 amino acids)

>GFF1998 hypothetical protein (Xanthobacter sp. DMC5)
MFRTTTRRLFCAGALAMAFASAGTAQAADKVKVGINNVVSDVVFHLGIERGIFAEEGLDV
QLIAFDSGPKMVAPLGAGQIDVGAGASSAGLYNAAARGIDIKVVADKGSTPVHYDYMPLM
VRKELVDSGKVKTIADLKGMRVGSVGPGAATNAKMAHLLAKAGLTYKDVSHNYIGYPQQI
AAFTTGAIDAAITTEPSVTQAVNNGVAVRFVVDGYPNQQVAVLLYGGDFIAKRRDVAQRF
MNAYVKAARIFNDATAGGKFDGKGADEVIKTIMRTTGLKDAELFKTMIPNGIDPDGKVDV
ASMAEDLKFFTENGYLERPAKVSDVVDTSFAENTLKALGPYKAAQN