Protein Info for GFF1994 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF00005: ABC_tran" amino acids 25 to 164 (140 residues), 106.6 bits, see alignment E=1.7e-34

Best Hits

Swiss-Prot: 42% identical to NRTD_SYNE7: Nitrate import ATP-binding protein NrtD (nrtD) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 75% identity to vpe:Varpa_0119)

MetaCyc: 45% identical to taurine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-64-RXN [EC: 7.6.2.7]

Predicted SEED Role

"ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component" in subsystem Alkanesulfonate assimilation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (257 amino acids)

>GFF1994 ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component (Hydrogenophaga sp. GW460-11-11-14-LB1)
VTMTDTVLHFDHVAIELGGRQILSPTELTVKRGEFVCVIGPSGCGKTTLLRAAAGFVTPS
QGSVRRKGVPITGPSREVAFVFQDYGRALLPWRTVQANVSLALEAANVPAAERPARIEHV
LKTVGLAAHGHKYPAQLSGGMQQRVQIARCLAQRPDVMMMDEPFGALDAMTRETLQDELA
RLVREEGLTVMFVTHDLEEALYLGDRVIALRSNPTPESPSLAALIDVPLPQPRDQLSTKE
HPEFLRLRRELYHYLGH