Protein Info for GFF1990 in Sphingobium sp. HT1-2

Annotation: NAD(P) transhydrogenase subunit beta (EC 1.6.1.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 38 to 56 (19 residues), see Phobius details amino acids 62 to 80 (19 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 134 to 156 (23 residues), see Phobius details amino acids 171 to 189 (19 residues), see Phobius details amino acids 195 to 215 (21 residues), see Phobius details amino acids 222 to 240 (19 residues), see Phobius details amino acids 246 to 265 (20 residues), see Phobius details PF02233: PNTB" amino acids 12 to 469 (458 residues), 652.3 bits, see alignment E=2.4e-200

Best Hits

Swiss-Prot: 68% identical to PNTB_RHORT: NAD(P) transhydrogenase subunit beta (pntB) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K00325, NAD(P) transhydrogenase subunit beta [EC: 1.6.1.2] (inferred from 83% identity to swi:Swit_1181)

Predicted SEED Role

"NAD(P) transhydrogenase subunit beta (EC 1.6.1.2)" in subsystem Phosphate metabolism (EC 1.6.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.1.2

Use Curated BLAST to search for 1.6.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (473 amino acids)

>GFF1990 NAD(P) transhydrogenase subunit beta (EC 1.6.1.2) (Sphingobium sp. HT1-2)
MHELAPVSPFVALAYLVSGVLFILALRGLSSPSTSRRGNRMGMVGMAIAVVTTLYTHDVL
SLPEILGAIAIGGGIGFIIARRIEMTAMPQLVAAFHSLVGLAAVLVGAAAYLNPGAFGIL
DPLTNEIHNASRIEMGLGVAIGAITFSGSVIAFLKLNGNMSGKPIMLPGRHVINLATLAA
ILGLIAYFVTDQSPWIFWTVTALSFVIGFLLIIPIGGADMPVVVSMLNSYSGWAAAAMGF
TLGNTAMIITGALVGSSGAILSYIMCKAMNRSFISVIAGGFGAEAGPSGGGAAAVDRPYK
RGSAEDAAFLMSQADNVIIVPGYGMAVSQAQHALREMADLLKKEGVNVKYAIHPVAGRMP
GHMNVLLAEANVPYDEVFELEDINSEFGQADVAFVIGANDVTNPAAKTDKTSPIYGMPIL
DVANAKSVLFVKRSMGGAGYAGVDNEVFYMDNTMMLLADAKKMVEEIVKALAH