Protein Info for GFF199 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Ribose ABC transport system, ATP-binding protein RbsA (TC 3.A.1.2.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 PF00005: ABC_tran" amino acids 23 to 174 (152 residues), 100.3 bits, see alignment E=1.5e-32 amino acids 276 to 428 (153 residues), 65 bits, see alignment E=1.2e-21

Best Hits

Swiss-Prot: 44% identical to RBSA_CHRVO: Ribose import ATP-binding protein RbsA (rbsA) from Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

KEGG orthology group: K10441, ribose transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 74% identity to sur:STAUR_0186)

Predicted SEED Role

"Ribose ABC transport system, ATP-binding protein RbsA (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (500 amino acids)

>GFF199 Ribose ABC transport system, ATP-binding protein RbsA (TC 3.A.1.2.1) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MAGAGVRIELRGIVKRFGPVQVLHGVDLAFEPGRVYGLLGENGAGKSTLMKILAGYEQPS
EGALQVNGRAVRFDGPRAAEAEGIVLIHQEFNLAEDLTVAQNIFLGHEKKRHGFWLDDSA
MRATARRVLDDVGLAKVHPDTRVRDLIVAERQLVEIAKALSRHARVLIMDEPTATLTPGE
TGRLFELVARLQADGVTVVFISHKLDEVERITEEVIVMRDGRLVAQQATATLTRAQMANL
MVGRELADLYPPRTEVPADAPVLLSVRALSVPGWAQDVSFEVRAGEVFGFAGLVGAGRTE
LFEGLLGLRERRAQAVQVAGRALLPRSPREAANAGLTYLSEDRKGRGLHVRFGLRENLTL
MALQRHARPWLQPASEVAALAQAVREFGIRTGSLDVPAGSLSGGNQQKLALAKVLHPDPR
VVVLDEPTRGVDIGAKRDIYALIQRLAASGRAVVVISSELMELIGLCHRVAVMRSGRLQA
TLSAADLNEQELIAHATGTH