Protein Info for GFF1982 in Xanthobacter sp. DMC5

Annotation: Inorganic pyrophosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 PF00719: Pyrophosphatase" amino acids 18 to 173 (156 residues), 192.7 bits, see alignment E=1.7e-61

Best Hits

Swiss-Prot: 80% identical to IPYR_BRADU: Inorganic pyrophosphatase (ppa) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K01507, inorganic pyrophosphatase [EC: 3.6.1.1] (inferred from 92% identity to xau:Xaut_2496)

MetaCyc: 76% identical to inorganic diphosphatase (Sinorhizobium meliloti 1021)
Inorganic diphosphatase. [EC: 3.6.1.1]

Predicted SEED Role

"Inorganic pyrophosphatase (EC 3.6.1.1)" in subsystem Phosphate metabolism (EC 3.6.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.1

Use Curated BLAST to search for 3.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (180 amino acids)

>GFF1982 Inorganic pyrophosphatase (Xanthobacter sp. DMC5)
MRIDAIPIGKNPPHDVNVLIEVPIGGEPIKYEMDKAAGTLFVDRFLYTAMRYPGNYGFIP
HTLSGDGDPCDVLVANTRAIVPGAVISARPVGVLLMEDEAGMDEKIIAVPSSKLTKRYDK
VLNYNDLPEITLKQIEHFFEHYKDLEPNKWVKIVGWRDAAEAQKLILEGIERAKAEGKEG