Protein Info for GFF1982 in Sphingobium sp. HT1-2

Annotation: Flp pilus assembly protein TadB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 119 to 138 (20 residues), see Phobius details amino acids 265 to 286 (22 residues), see Phobius details amino acids 300 to 325 (26 residues), see Phobius details PF00482: T2SSF" amino acids 157 to 281 (125 residues), 92.6 bits, see alignment E=9.9e-31

Best Hits

KEGG orthology group: K12510, tight adherence protein B (inferred from 83% identity to sjp:SJA_C1-24500)

Predicted SEED Role

"Flp pilus assembly protein TadB" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (332 amino acids)

>GFF1982 Flp pilus assembly protein TadB (Sphingobium sp. HT1-2)
MDGNFLLILVLVATMLGLVVVAFAGPSPDKAQKRRVALIRGRHSDSTEAMMEARMRKAIS
TRATGNEAKMLVSLIPNPENLAKRIRMTGKKWTLSQYMTSCAVVFLLTTLFLLMRGFPFL
LALMVGLAAGLALPHLWVGRLINKRIQQFNAKFPDALELLTRGLRSGLPVGETLGIVSSE
IPGPVGEEFKLITERIKIGKSMDQALQETADRLGTPEFQFFVITLAIQRETGGNLAETLQ
NLATVLRQRAQMKLKIRAMSSESKASAYIIGVLPFLVFGMICYINFGYMSPFFTPDPAGI
FGLSTMQVVGIGGMCWMAIGAFIMAQMINFEI