Protein Info for GFF1980 in Sphingobium sp. HT1-2

Annotation: Flp pilus assembly protein CpaD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF09476: Pilus_CpaD" amino acids 15 to 199 (185 residues), 156.9 bits, see alignment E=2.8e-50

Best Hits

KEGG orthology group: K02281, pilus assembly protein CpaD (inferred from 74% identity to sch:Sphch_1368)

Predicted SEED Role

"Flp pilus assembly protein CpaD" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (217 amino acids)

>GFF1980 Flp pilus assembly protein CpaD (Sphingobium sp. HT1-2)
MTSTSRKTLVRLGALALLALPLAACSTDSVNRGVDSVHQPVVSYASYTFDVQAGDARLAP
AEAARLDDWFATIKLGYGDQVAIVTDAGYYSPDLGEDIANVVARHGMLLGQDSSAAAGSA
PEGTIRLVVRRTTASVPGCPDWSNKAETPMSLGASSNFGCGVNSNLAAMVADPEDLVRGQ
STDSELRTATSNRAISTYRDKAPTGSGDLKQLSNGGQ