Protein Info for GFF1977 in Sphingobium sp. HT1-2

Annotation: Type IV prepilin peptidase TadV/CpaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 37 to 55 (19 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 96 to 122 (27 residues), see Phobius details amino acids 133 to 153 (21 residues), see Phobius details PF01478: Peptidase_A24" amino acids 13 to 117 (105 residues), 60.9 bits, see alignment E=7.4e-21

Best Hits

KEGG orthology group: K02278, prepilin peptidase CpaA [EC: 3.4.23.43] (inferred from 77% identity to sjp:SJA_C1-24450)

Predicted SEED Role

"Type IV prepilin peptidase TadV/CpaA" in subsystem Widespread colonization island

Isozymes

Compare fitness of predicted isozymes for: 3.4.23.43

Use Curated BLAST to search for 3.4.23.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (157 amino acids)

>GFF1977 Type IV prepilin peptidase TadV/CpaA (Sphingobium sp. HT1-2)
MLGEYFRLALIAALGILLIAAAITDLRARIISNRLNLGVAALAPLWWIACGLPLWPGMAV
QLLVGLLVFVLFAALFAFGMMGGGDVKLLGALALWFPWQAVLTLLTLMAILGGAVTIVTV
IHHRLRRKQGQPEIPYGVAISIAALWLLGERYLNQFA