Protein Info for GFF1976 in Sphingobium sp. HT1-2

Annotation: lysophospholipase L2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 PF12146: Hydrolase_4" amino acids 43 to 298 (256 residues), 115.1 bits, see alignment E=6.6e-37 PF00561: Abhydrolase_1" amino acids 46 to 285 (240 residues), 47.6 bits, see alignment E=3.7e-16 PF02129: Peptidase_S15" amino acids 61 to 271 (211 residues), 29.5 bits, see alignment E=1.2e-10 PF12697: Abhydrolase_6" amino acids 66 to 285 (220 residues), 50.1 bits, see alignment E=1.2e-16

Best Hits

KEGG orthology group: K01048, lysophospholipase [EC: 3.1.1.5] (inferred from 77% identity to sjp:SJA_C1-24440)

Predicted SEED Role

"Lysophospholipase L2 (EC 3.1.1.5)" in subsystem Synechocystis experimental or Triacylglycerol metabolism (EC 3.1.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>GFF1976 lysophospholipase L2 (Sphingobium sp. HT1-2)
MDSPIFPSPALDRRAWPMGGQLDYWQAPDGWPIRRYRLGAGDRGRMLILNGRGDMIEKYL
EVIHHWAQRGWAVTSFDWRGQGGSGRLTDDPLCGHIDDFARWIGDLRALSNDWRAEGSGP
TVMLGHSMGGHMLLRTLAEGFPAPDAAVAVAPMLGLHTAPLPRWLAVAIATVMCAIGQGE
KRAWTQKEESERQRQMRQKRLTHDPDRYADEIWWRDHSRDIALGPPSWNWVRLALESTRA
LEAGNGPERIAAPTLVLAACRDQLVSTPAIRRIAARLPDARLHVYGREAAHEILRELDPV
RLDALGRIDRFLDEVAR